SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1X8W3V1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1X8W3V1
Sequence length 60
Comment (tr|A0A1X8W3V1|A0A1X8W3V1_SALEN) Lipoprotein Rz1 {ECO:0000313|EMBL:KOX81404.1} KW=Complete proteome OX=149539 OS=Salmonella enteritidis. GN=ABA47_4655 OC=Enterobacteriaceae; Salmonella.
Sequence
MLKLKMMLCVMMLPLVVVGCTSKQSVSQCVKPPPPPAWIMQPPPDWQTPLNGIISPSERG
Download sequence
Identical sequences A0A1Q5D806 A0A1X8W3V1 K7P6R7 K7PHU6 Q37935
YP_001551744.1.28658 YP_007111840.1.73778 YP_007112604.1.84097 595496.BWG_3717 gi|160338810|ref|YP_001551744.1| gi|428782077|ref|YP_007111840.1| gi|428782853|ref|YP_007112604.1| gi|238903115|ref|YP_002928911.1| RZ1_LAMBD

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]