SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A1CSZ8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A1CSZ8
Domain Number 1 Region: 133-305
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 8.03e-38
Family PHB depolymerase-like 0.036
Further Details:      
 
Domain Number 2 Region: 33-131
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 0.000000000000169
Family PHB depolymerase-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A1CSZ8
Sequence length 308
Comment (sp|A1CSZ8|AXE1_ASPCL) Probable acetylxylan esterase A KW=Complete proteome; Reference proteome OX=344612 OS=3887 / NRRL 1). GN=axeA; OC=Eurotiomycetidae; Eurotiales; Aspergillaceae; Aspergillus.
Sequence
MAPFSFLLTLLLYTLSAGASVLESRSSALLPRAGSLQQVTNFGDNPTNVGMYIYVPNNLA
SNPGIIVAIHYCTGTAEAYYNGSPYAKLAEKHGFIVIYPESPYQGKCWDVSSRASLTHNG
GGNSNSIANMVKWTIKKYKTNTSKVFVTGSSSGAMMTNVMAATYPDMFAAGVVYSGVAAG
CFMSNTNQQAAWNSTCAHGKSIATPEAWAHVAKAMYPGYDGPRPRMQIYHGSADTTLYPQ
NYQETCKEWAGVFGYDYNAPRSVENNKPQANYKTTTWGKELQGIYATGVGHTVPINGDRD
MAWFGFAK
Download sequence
Identical sequences A1CSZ8
XP_001267861.1.35617 5057.CADACLAP00007444 ACLA_081220

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]