SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A1SG09 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A1SG09
Domain Number 1 Region: 61-285
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 5.35e-30
Family Haloperoxidase 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A1SG09
Sequence length 295
Comment (tr|A1SG09|A1SG09_NOCSJ) Uncharacterized protein {ECO:0000313|EMBL:ABL80744.1} KW=Complete proteome; Reference proteome OX=196162 OS=Nocardioides sp. (strain ATCC BAA-499 / JS614). GN=Noca_1230 OC=Nocardioides.
Sequence
MASSGAQKRTIVRSIIRIGFGLLDRVAPGLGARLVIRIWFRIPRGMPLVAPTGAPFEVRW
QGRTLRGQVWGEGPPVYLVHGWGGNGDQMRHFVEPLVAAGHRVVAYDGPSHGRSDAGRHG
PETTDAVELAQALDAVVAEFGPARAVVAHSLGTLSLLLALRDGWFTAERVVLVAPVDGVP
GFTAYFRRLLGFGDRVQRHTERLVEERTGYRPDELQTLLLAERPGLPEALVVQDRDDRSV
GTGLARELAAGWPGATYLETRGLGHSRVLADPDVVASVVRFVADEVADARDELAS
Download sequence
Identical sequences A1SG09
196162.Noca_1230 WP_011754692.1.100580 WP_011754692.1.96005 gi|119715466|ref|YP_922431.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]