SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A1SHD3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A1SHD3
Domain Number 1 Region: 5-183
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 8.63e-23
Family Aclacinomycin methylesterase RdmC 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A1SHD3
Sequence length 220
Comment (tr|A1SHD3|A1SHD3_NOCSJ) Uncharacterized protein {ECO:0000313|EMBL:ABL81218.1} KW=Complete proteome; Reference proteome OX=196162 OS=Nocardioides sp. (strain ATCC BAA-499 / JS614). GN=Noca_1705 OC=Nocardioides.
Sequence
MSTAERRVDTPHGEARLVVDQARAPVATVLLSHGAGAGIDTADLEALARHLPRNGITVVR
LEQPWKVAGRKVATAPATLDAALVAAANRLRTRTPLVLGGRSAGARSALRCARQLAASGC
LALSFPLHPPGHPEKTRLDELRGAGVPTLVIQGERDPMGRPEEFPDGVDLCVVPGADHGL
KVPARGPIAQSEALEIVVESALEWIVREVAGGGRGNDGPA
Download sequence
Identical sequences A1SHD3
gi|119715940|ref|YP_922905.1| WP_011755165.1.100580 WP_011755165.1.96005 196162.Noca_1705

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]