SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A1UMG8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A1UMG8
Domain Number 1 Region: 17-256
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 3.22e-41
Family Bacterial lipase 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A1UMG8
Sequence length 263
Comment (tr|A1UMG8|A1UMG8_MYCSK) Alpha/beta hydrolase fold protein {ECO:0000313|EMBL:ABL94026.1} KW=Complete proteome; Reference proteome OX=189918 OS=Mycobacterium sp. (strain KMS). GN=Mkms_4836 OC=Mycobacterium.
Sequence
MAGQDEHMDSPLLTPRGGEGAPLVLVHGLMGRGSTWGRQLPWLTGLATVYTYDAPWHRGR
DVVDPHPISTEHFVAELGDAVARLGSPVTLIGHSMGGLHAWCLAATRPDLVNAVVVEDMA
PDFRGRTTGPWEPWLHALPVEFETEQQVFAEFGPIAGRYFLEAFDRTATGWRLHGRRRHW
IDIAAEWGLRDYWQQWEQVRVPALLLEAGNSVTPPGQMRRMAEIGHRTTYLRVPDAGHLI
HDEQPEVYRGAVEAFLATLAQRA
Download sequence
Identical sequences A1UMG8
gi|119870864|ref|YP_940816.1| gi|108801713|ref|YP_641910.1| 164756.Mmcs_4750 189918.Mkms_4836

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]