SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A2WLM0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A2WLM0
Domain Number 1 Region: 32-298
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 3.45e-27
Family Epoxide hydrolase 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A2WLM0
Sequence length 347
Comment (tr|A2WLM0|A2WLM0_ORYSI) Uncharacterized protein {ECO:0000313|EMBL:EAY72866.1} KW=Complete proteome; Reference proteome OX=39946 OS=Oryza sativa subsp. indica (Rice). GN=OsI_00738 OC=Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa.
Sequence
MGDSSGSVSIDVERISFGGKEHRVRTRYGSVSVSVFGDEDKPALITYPDVALNYMSCFQG
LFFCPEAASLLLHNFCIYHITPQGHELGAAPISSDVPVPSVDELVDQVADVLDFFGLGSV
MCLGVTAGAYILTLFATKYRDRVIGLMLVSPLCKAPSWSEWLYNKVLLNLLYYYGSRGLV
KECLLQRYFSTEVRGNGQDPESEIVQACRSLLHERQGSNVWRFLQAINERHDLTEALKKL
QCRTLIFVGENSQFHDDAVHMTTKLDRRYCALVEVQACGSLVTEEQPHAMLIPMEYFLMG
YGLYRPSQLDSSPRSTLNPFCISPELLSPESMGVKLKPIKTRISLKV
Download sequence
Identical sequences A0A0D3EKK5 A0A0D9Y4G2 A0A0E0FHI2 A2WLM0 I1NL22
ORGLA01G0056200.1 ONIVA01G06860.1 OGLUM01G06480.1 OsIBCD000607 OBART01G05920.1 39946.BGIOSIBCE000707

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]