SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A5UV33 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A5UV33
Domain Number 1 Region: 18-257
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 1.33e-47
Family Carbon-carbon bond hydrolase 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A5UV33
Sequence length 265
Comment (tr|A5UV33|A5UV33_ROSS1) Alpha/beta hydrolase fold {ECO:0000313|EMBL:ABQ90486.1} KW=Complete proteome; Reference proteome OX=357808 OS=Roseiflexus sp. (strain RS-1). GN=RoseRS_2105 OC=Roseiflexaceae; Roseiflexus.
Sequence
MKDADDDTRVVQRRDCAIAGPEGAPVFVLIHGARLTRAMWQPQIEALSDTFRVIAPDLPG
HGALAGVPFSLDAAVEQVAAVVDAIVGERVIVCGLSLGGYVALAFGARYPSRATALILSG
CAFAFNGFAGRLLRAPYLAIARLLTANFAPLLARAEERTFRKRYPPALADAIVARGFFYR
FYPEISAALIDFDPLPALRACECPVLLLNGAADRFFRRDERLYLRTLRAGRVRLIEGAAH
LANLDQPEAYTQALRDFATEMATVR
Download sequence
Identical sequences A5UV33
gi|148656231|ref|YP_001276436.1| WP_011956832.1.23570 357808.RoseRS_2105

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]