SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A7ETA3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A7ETA3
Domain Number 1 Region: 3-251
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 5.41e-18
Family Haloalkane dehalogenase 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A7ETA3
Sequence length 259
Comment (tr|A7ETA3|A7ETA3_SCLS1) Uncharacterized protein {ECO:0000313|EMBL:EDN92695.1} KW=Complete proteome; Reference proteome OX=665079 OS=mold) (Whetzelinia sclerotiorum). GN=SS1G_08558 OC=Helotiales; Sclerotiniaceae; Sclerotinia.
Sequence
MSSKPTFVLIPGAWHRAEIWEKVTSLLEEQQYKCIPVELPSTAGDPTIAFGDDIAVVRNI
VLSETKQGRDVIIVVHSYGGAVGQSAVKGLTHHNPDDIQSTSDEPTGHVIGLVMMACGFG
QTGISFIDAIGGTPPPLWRWDDSGFATLELPAREIFYHDLSEEEGKFWVSRLMKQSQKVL
KEGGEWAYAGWMDLPVWYLMTMDDKSFPVGVQEMFVKMARDAGADVTVRQVMSSHSPMLS
RPKETVDFILEAAVSLVKE
Download sequence
Identical sequences A0A1D9QDM4 A7ETA3
SS1T_08558 XP_001590818.1.14510 665079.A7ETA3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]