SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A7HHE1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A7HHE1
Domain Number 1 Region: 1-260
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 1.8e-67
Family Haloperoxidase 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A7HHE1
Sequence length 264
Comment (tr|A7HHE1|A7HHE1_ANADF) Alpha/beta hydrolase fold {ECO:0000313|EMBL:ABS28137.1} KW=Complete proteome; Reference proteome OX=404589 OS=Anaeromyxobacter sp. (strain Fw109-5). GN=Anae109_3959 OC=Cystobacterineae; Anaeromyxobacteraceae; Anaeromyxobacter.
Sequence
MPIAHVNGTDLHYRDAGTAHKDVLLLLHAFPLHSGMWLRQIAALEGRWRIVAPDYRGLGQ
SAPRGEASTMQVLAEDVRALLQHLRIERAAVAGLSMGGYLSLELYRQIPGFFRGLALCDT
RAGADTDEGKAGREKFAQTAIERGLEWVADEMIPKLLRPEPDPAVAKEVRDLIRRGTPAG
VAAAQRGMAQRPDSTETLAKITCPTLVLVGAEDTLTPPAESEKMAKAIKGAKLVKVKKAG
HLANLEATAAFNAALQEFLDGLPA
Download sequence
Identical sequences A7HHE1
404589.Anae109_3959 WP_012098772.1.20576 gi|153006796|ref|YP_001381121.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]