SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A9UKK2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A9UKK2
Domain Number 1 Region: 3-286
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 4.73e-64
Family Aclacinomycin methylesterase RdmC 0.0005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A9UKK2
Sequence length 295
Comment (tr|A9UKK2|A9UKK2_9BACT) Lipase/esterase {ECO:0000313|EMBL:AAX37299.1} OX=77133 OS=uncultured bacterium. GN= OC=Bacteria; environmental samples.
Sequence
MARVRTNGIELEYEVLGPEHGQPMVLIMGLGAQMILWRDDFCQMLVEHGYRVIRFDNRDV
GRSTWLDHLGLPNVMGLMAAAAAGQPVDAPYKLSDMAADTAGLLDALGISQAHIVGASMG
GMIAQTFAIEYPERALSLTSIMSTTGDPTLPPPRPEALSVLLAPQPSSREEAIERGVLIF
RTIGSPKYFDEAEIRELAARAFDRGINPAGVMRQLAAILASGNRTEALRKVDQPALVIHG
RIDPLVPFAAGEATARALPRAELLAFEDMGHDMPRPLWPAMVDAIHRVAQQARQR
Download sequence
Identical sequences A9UKK2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]