SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B2A9K6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B2A9K6
Domain Number 1 Region: 31-281
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 2.13e-24
Family Haloperoxidase 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) B2A9K6
Sequence length 284
Comment (tr|B2A9K6|B2A9K6_PODAN) Podospora anserina S mat+ genomic DNA chromosome 1, supercontig 1 {ECO:0000313|EMBL:CAP59753.1} KW=Complete proteome; Reference proteome OX=515849 OS=(Pleurage anserina). GN=PODANS_1_80 OC=Podospora.
Sequence
MAPFKVVVHPLASEPTDSSHSPSLTAYESEPFSSPNALVFIHGLTAGPHTTDLTHLQAAL
PSEYSIWELRMRSSYSGWGYSSLDNDVQDLTRLVRYLREDLKIKRIVLMGASTGCQGALE
YNNHSSQPPRVDGYILTSPVSDREAANALWSSEALAESLAVAKELIDQGKECATMPKEHV
PFFATPVTAARWWKDNFASDLSDEVLAGKFGRVDKPLLILPAEKDEMVPASVDKQLLLER
WSTAAPKGVVSELSGFIPDADHVVSSSEAQKWLAERVAKFLSSI
Download sequence
Identical sequences B2A9K6
XP_001912274.1.27508 Pa_1_80|chrm1_SC1|Putative

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]