SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B2ADA9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B2ADA9
Domain Number 1 Region: 62-145,199-253
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 0.00000000000413
Family A novel bacterial esterase 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) B2ADA9
Sequence length 256
Comment (tr|B2ADA9|B2ADA9_PODAN) Podospora anserina S mat+ genomic DNA chromosome 4, supercontig 1 {ECO:0000313|EMBL:CAP61424.1} OX=515849 OS=(Pleurage anserina). GN=PODANS_4_580 OC=Podospora.
Sequence
MNLPIIRCCTGPSDGVFNHHACQNHQLVMDSIPADAHTREVFYVGGEYVDDGTGNETVYG
QVYVEHLVPVRKPLQKYPIIFIPGSSRTGIDFLTTPANNDNNTNSPTQQSWSSHFLSLSH
ELYLIDPPFRGRSPWHPPTHLSSSSSSSPYLTFGAAPLQKAWATPPSSTQWPDSPPAGKG
SPAFDHVMRSTHPQLANLAEEQSVAQKSLAALLDKIGKPAILLAHSMGCKIAWLLADARP
GLVKAIVAVEPAGPAF
Download sequence
Identical sequences B2ADA9
Pa_4_580|chrm4_SC1|Putative XP_001903649.1.27508

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]