SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B2AEM4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B2AEM4
Domain Number 1 Region: 45-246
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 0.00000000293
Family Epoxide hydrolase 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) B2AEM4
Sequence length 261
Comment (tr|B2AEM4|B2AEM4_PODAN) Podospora anserina S mat+ genomic DNA chromosome 5, supercontig 1 {ECO:0000313|EMBL:CAP61890.1} KW=Complete proteome; Reference proteome OX=515849 OS=(Pleurage anserina). GN=PODANS_5_2100 OC=Podospora.
Sequence
MGLSLASKVLVSASDQPQVLEFSSGKLTLQSTGMAAFDGPFFSHTAGYSPEQMIEAHEHL
DRTIDDLGPFDGILGFSQGGALALSYLHRKQTQNELRPFKFALIMSSVIPCSADVGVCEE
VIQSLCDQTDPSAVDQEQRVFVELLDRTVGEARKNNALLPDIDLSIYEAGGDPSLAPRIM
HPSFVKQKIWIPTVHVAGKKDYSFMRAMSDVAYAVCEPKLAKKMVHSGGHQPPQKPSEVK
EVIRALDWAIGMSDRFAHWNL
Download sequence
Identical sequences B2AEM4
Pa_5_2100|chrm5_SC1|Putative XP_001904113.1.27508

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]