SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B2ANG4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B2ANG4
Domain Number 1 Region: 30-255
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 0.0000000000000156
Family Carboxylesterase/thioesterase 1 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) B2ANG4
Sequence length 280
Comment (tr|B2ANG4|B2ANG4_PODAN) Putative Seine Hydrolase {ECO:0000313|EMBL:CDP31582.1} KW=Complete proteome; Reference proteome OX=515849 OS=(Pleurage anserina). GN=PODANS_6_10800 OC=Podospora.
Sequence
MAETQSGTQTPISGASTPVPRGKAVNNKPPKKEVKILMLHGYTQSGPLFRAKTRAVEKLL
VKALAPRNLIPSLIYPTAPNRLYPRDIPGYQPSSDNEGREDEEIDSWAWFRKDEATGSYR
LVQQGMLQLASAIEETGGGIEGVIGFSQGGCVASILAAALEGFRQPAEEHKEWVGSIRAA
NGGQPLKFWVSYSGFWAVDQDLSGWLYQPKVKTPSLHYFGGLDTVVDESRSQGLVERSEG
AVKVVHPGGHYVPVSKEWVVPLAGFVLQSLTEAPREDEKL
Download sequence
Identical sequences B2ANG4
XP_003437503.1.27508 Pa_6_10800|chrm6_SC4|Putative

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]