SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B2ATB3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B2ATB3
Domain Number 1 Region: 40-223
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 1.78e-42
Family Cutinase-like 0.00000071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) B2ATB3
Sequence length 225
Comment (tr|B2ATB3|B2ATB3_PODAN) Cutinase {ECO:0000256|RuleBase:RU361263} KW=Complete proteome; Reference proteome OX=515849 OS=(Pleurage anserina). GN=PODANS_1_15270 OC=Podospora.
Sequence
MQFLTTVLALAGAVAALPVEQKTEIVEARQLFGSDTKNELINGGACPPVIFIYARGSTER
GNLGTLGPSVGDALKDRFGSANVWVQGVGGAYTADLLDNALPDGTTRAAIAEMKGLLTLA
HTKCPSAKVVAGGYSQGAALAAASISTSTAAIREQIKGVVLFGYTKNLQNLGRIPDYPRE
RTEVYCATGDLVCTGTLIVTAAHLTYGDEARNEAPRFLIARINAS
Download sequence
Identical sequences B2ATB3
XP_001906965.1.27508 Pa_1_15270|chrm1_SC4|Putative

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]