SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B3PQP4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B3PQP4
Domain Number 1 Region: 25-119,159-245
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 3.83e-25
Family Hydroxynitrile lyase-like 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) B3PQP4
Sequence length 252
Comment (tr|B3PQP4|B3PQP4_RHIE6) Putative hydrolase protein {ECO:0000313|EMBL:ACE91467.1} KW=Complete proteome OX=491916 OS=Rhizobium etli (strain CIAT 652). GN=RHECIAT_CH0002515 OC=Rhizobiaceae; Rhizobium/Agrobacterium group; Rhizobium.
Sequence
MNKHLTFIAALAFTTAGIAFAAQAAAVKNIVIVHGALADGSGWRKATEILEKRGFNVTIV
QEPLTSLDDDVAATKRVLDLQEGPTLLVGHSYGGMVITEAGNDPGVAGLVYVAAFQPDKG
ESLLSLASSKPAGSMDIKETKDGKYLYLDPGAFAADFAADLPKAEADFLAKSQVFAAKQA
FAAKIAEPAWRTKPSWSIVATGDHAINPDLEREMAKRAGSNVTEIKASHAVFASQPEKVA
DVIEKAAKKVGE
Download sequence
Identical sequences B3PQP4
491916.RHECIAT_CH0002515 WP_012484089.1.25642 WP_012484089.1.49700 WP_012484089.1.76514 WP_012484089.1.81019 WP_012484089.1.82165 gi|190892103|ref|YP_001978645.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]