SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B3PS17 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B3PS17
Domain Number 1 Region: 19-138
Classification Level Classification E-value
Superfamily Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase 4.83e-33
Family 3-demethylubiquinone-9 3-methyltransferase 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) B3PS17
Sequence length 140
Comment (tr|B3PS17|B3PS17_RHIE6) Hypothetical conserved protein {ECO:0000313|EMBL:ACE93307.1} KW=Complete proteome OX=491916 OS=Rhizobium etli (strain CIAT 652). GN=RHECIAT_CH0004380 OC=Rhizobiaceae; Rhizobium/Agrobacterium group; Rhizobium.
Sequence
MDTTTENNPAKLPPVKNGLLPYLTVDGAVQAAEFYKRAFGAEEAHRVPVDESGRTMHIHL
YINGSSLMLADAYPEYGHPFKGHEGFAIQLVIDDIDFWWERAVAAGAEVVMPIELMFWGD
RYGQLRDPFGVLWGLNAPSK
Download sequence
Identical sequences B3PS17
WP_012485653.1.25642 gi|190893943|ref|YP_001980485.1| 491916.RHECIAT_CH0004380

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]