SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B3PSZ9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B3PSZ9
Domain Number 1 Region: 56-283
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 1.82e-34
Family Lipase 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) B3PSZ9
Sequence length 284
Comment (tr|B3PSZ9|B3PSZ9_RHIE6) Putative hydrolase protein {ECO:0000313|EMBL:ACE90165.1} KW=Complete proteome OX=491916 OS=Rhizobium etli (strain CIAT 652). GN=RHECIAT_CH0001184 OC=Rhizobiaceae; Rhizobium/Agrobacterium group; Rhizobium.
Sequence
MEKPVKTARLFLCLAAFAVTVPEAPADAEELVRFESVPVKLSPFRIRKARELGEILPQPQ
GTPLLGYLSRPPGDGPFPAVVVMHGCDGLRASVRELWPKRLVSWGYVVLVVDSFTSRNLA
DTCPSRVPDRVFDAYGALDFLAQSGFVDIGRVALMGFAAGGTATLDATKIEGYEQLVERK
FKAAIAYYPACDADRGDATVPSLILTGERDNWSRPERCQKRLARLGDDSPPIELDIYKGT
YHGFDAPEFAVGKRVLGHIEKYNPDAAGKSIRSVYAFLRRYLGR
Download sequence
Identical sequences B3PSZ9
gi|190890801|ref|YP_001977343.1| 491916.RHECIAT_CH0001184 WP_012483045.1.25642

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]