SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B3Q153 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B3Q153
Domain Number 1 Region: 1-259
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 5.63e-63
Family Haloperoxidase 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) B3Q153
Sequence length 269
Comment (tr|B3Q153|B3Q153_RHIE6) Beta-ketoadipate enol-lactone hydrolase protein {ECO:0000313|EMBL:ACE93409.1} KW=Complete proteome OX=491916 OS=Rhizobium etli (strain CIAT 652). GN=RHECIAT_PA0000063 OC=Rhizobiaceae; Rhizobium/Agrobacterium group; Rhizobium.
Sequence
MQFARINDVTIHYQVIGAPADRPVIVFINSLGTDFRIWRDVVVRLAGDFAIILYDKRGHG
LSDVGQLPASIEDHATDLAGLLDLLSVKNAVICGLSVGGLVALSLYQRRPDLVGALVLSD
TAHKIGTAESWNARIAAVEQNGIGSIVDAVMERWFTPAFRRPENTSYSGYCNMLTRQPVE
GYIAACEAIRDADLTEAAKRVAVPTICIVGDQDGSTPPDLVLATAKLIPGARYEVIPNCA
HIPCVEQPEALTAIIRAFLTSISPGDSSP
Download sequence
Identical sequences B3Q153
gi|190895380|ref|YP_001985672.1|NC_010998 WP_012490452.1.25642 491916.RHECIAT_PA0000063 gi|190895380|ref|YP_001985672.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]