SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B3Q5Q8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B3Q5Q8
Domain Number 1 Region: 3-285
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 4.02e-63
Family Epoxide hydrolase 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) B3Q5Q8
Sequence length 289
Comment (tr|B3Q5Q8|B3Q5Q8_RHIE6) Putative hydrolase protein {ECO:0000313|EMBL:ACE94539.1} KW=Complete proteome OX=491916 OS=Rhizobium etli (strain CIAT 652). GN=RHECIAT_PC0000461 OC=Rhizobiaceae; Rhizobium/Agrobacterium group; Rhizobium.
Sequence
MFEGFSLETVDVGLGSLRVRIGGEGPAVLLLHGHPRTHLTWSKVADLLSPDYTVVCPDLP
GFGRSYQPVDAADSKNSSKRAKAEALVELMRRLEHENFVVVGHDRGSLTAFRMAMDHPDR
VRKLVIADGIPVIEHLERADWKFARDWYHWFFFAQPAKPERAILADPLAWYDKLSPALMG
RLAYDDLIGVIHDPHVIHGMIEDYRAGLSVDHLHDRADRDAGRKVTCPMLCLWSLRDDME
QIYGDPVAIWRNWADDVRGFGIDSGHHVAEENPEALSAAIREFLEADGA
Download sequence
Identical sequences B3Q5Q8
gi|190894796|ref|YP_001985089.1|NC_010997 491916.RHECIAT_PC0000461 WP_012489967.1.25642 gi|190894796|ref|YP_001985089.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]