SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B5ZNY8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B5ZNY8
Domain Number 1 Region: 2-277
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 2.75e-63
Family Haloperoxidase 0.0000000142
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) B5ZNY8
Sequence length 278
Comment (tr|B5ZNY8|B5ZNY8_RHILW) Alpha/beta hydrolase fold {ECO:0000313|EMBL:ACI54949.1} KW=Complete proteome OX=395492 OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304). GN=Rleg2_1660 OC=Rhizobiaceae; Rhizobium/Agrobacterium group; Rhizobium.
Sequence
MAYVTTKDGVEIFFKDWGRKDAQPIVFHHGWPLSSDDWDAQMLFFLSKGYRVVAHDRRGH
GRSAQVSDGHDMDHYAADAFAVAEHLDLKNAVHIGHSTGGGEVARYVARHGQPSGRVAKA
VLVSAVPPLMVKTDGNPEGLPMEVFDGFRSALAVNRAQFFRDVPAGPFYGFNRDGATVQE
GVIQNWWRQGMMGGAKAHYDGIKAFSETDQTEDLKAITVPTLVLHGEDDQIVPIADSALK
SAKLLKNGTLTTYPGFSHGMLTVNADVLNADLLAFVRA
Download sequence
Identical sequences B5ZNY8
gi|209549258|ref|YP_002281175.1| 395492.Rleg2_1660 WP_012557601.1.20038

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]