SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B6A3X7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B6A3X7
Domain Number 1 Region: 8-265
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 2.58e-62
Family Haloperoxidase 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) B6A3X7
Sequence length 275
Comment (tr|B6A3X7|B6A3X7_RHILW) 3-oxoadipate enol-lactonase {ECO:0000313|EMBL:ACI59110.1} KW=Complete proteome OX=395492 OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304). GN=Rleg2_5939 OC=Rhizobiaceae; Rhizobium/Agrobacterium group; Rhizobium.
Sequence
MTEEIDVQFARINDVTIHYQVIGAPADRPVIVFVNSLGTDFRIWRDVVVRLAGDYAIVLY
DKRGHGLSDVGQLPSSIEDHATDLAGLLDLLSVKDAVILGLSVGGLIAQSLYQRRPDLVG
ALILCDTAHKIGTAESWNARIAAVERNGIGSIVDAIMERWFTPAFRRPESTAYSGYCNML
TRQPVEGYIAACEAIRDADFTEAAKRITVPTICIVGDQDGSTPPDLVLSTAKLIPGARYE
VIPDCAHIPCVEQPEALTVIIRAFLTTLAPGETNR
Download sequence
Identical sequences B6A3X7
gi|209546320|ref|YP_002278210.1|NC_011366 gi|209546320|ref|YP_002278210.1| 395492.Rleg2_5939

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]