SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B7VIX6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B7VIX6
Domain Number 1 Region: 6-200
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 1.4e-22
Family Hypothetical protein VC1974 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) B7VIX6
Sequence length 201
Comment (tr|B7VIX6|B7VIX6_VIBTL) Esterase {ECO:0000313|EMBL:CAV17430.1} KW=Complete proteome; Reference proteome OX=575788 OS=Vibrio tasmaniensis (strain LGP32) (Vibrio splendidus (strain Mel32)). GN=VS_0422 OC=Vibrionaceae; Vibrio.
Sequence
MFDSEQQAAKPPLLLYIHGFNSSSRSHKATVMADYCAEHRPDIKVMTPQLPSFPQQAAIY
LQQLVEQYKEQYQIALVGSSLGGYLSTWLNTHYGFKAVVVNPAVKPYELLVDYLGEQVNP
YTEERYVLETKHINELKALEVPAIAQPSDFWLLQQTEDEVLDYRQAVEKYQGAVQTVEEG
GDHSFVNFERYPQQIITFLNL
Download sequence
Identical sequences B7VIX6
575788.VS_0422 gi|218708459|ref|YP_002416080.1| WP_012603197.1.409

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]