SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B7WWH4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B7WWH4
Domain Number 1 Region: 9-229
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 1.99e-33
Family Atu1826-like 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) B7WWH4
Sequence length 234
Comment (tr|B7WWH4|B7WWH4_COMTK) Alpha/beta hydrolase fold protein {ECO:0000313|EMBL:EED65877.1} KW=Complete proteome OX=399795 OS=Comamonas testosteroni (strain DSM 14576 / KF-1). GN=CtesDRAFT_PD0823 OC=Comamonadaceae; Comamonas.
Sequence
MTEPAQLALVPGLNNTRAVFDGVLAALPAAVQATVLDNPPLETVEAIAAAHLGALPERFW
LAGFSFGGYVALAMLEQAPERVQGIALLCTAPFADSPAAAQKRIAALQAVAQGRYFEMVE
AATANTLHPDSLTNAALLQARQAMVRDYGPGRYAAHVRATAARPDRARLLDGGRPTLVLA
GSHDQLFTPDALATYAARIPGAQQRVVGPAGHLAPMEQPQAVARALALWMGVAG
Download sequence
Identical sequences B7WWH4
WP_003052143.1.80533

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]