SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B8A2J2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  B8A2J2
Domain Number - Region: 40-119,157-182
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 0.00356
Family Proline iminopeptidase-like 0.081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) B8A2J2
Sequence length 299
Comment (tr|B8A2J2|B8A2J2_MAIZE) Pectin acetylesterase {ECO:0000256|RuleBase:RU363114} OX=4577 OS=Zea mays (Maize). GN= OC=Zea.
Sequence
MKPLSFSGILGGNQKSNPDFYNWNRVKIRYCDGSSFTGDVEAVDTAKDLRYRGFRVWRAV
IDDLLTVRGMSKAQNALLSGCSAGGLAAILHCDRFHDLFPAKTKVKCFSDAGYFFDGKDI
SGNFYARSIYKSVVNLHGSAKNLPASCTSKPKQSPELCMFPQYVVPTMRTPLFILNAAYD
SWQVKNVLAPSPADPKKTWAQCKLDIKSCSASQLTTLQNFRTDFLAALPKTQSVGMFIDS
CNAHCQSGSQDTWLADGSPTVNKTQIGKAVGDWYYDREVPRQIDCPYPCNPTCKNRDDD
Download sequence
Identical sequences B8A2J2
GRMZM2G156365_T02|PACid:20846108 NP_001146615.1.34533 GRMZM2G156365_P02

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]