SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C5CU01 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C5CU01
Domain Number 1 Region: 5-289
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 1.08e-79
Family Hypothetical esterase YJL068C 0.00000367
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) C5CU01
Sequence length 291
Comment (tr|C5CU01|C5CU01_VARPS) S-formylglutathione hydrolase {ECO:0000256|RuleBase:RU363068} KW=Complete proteome OX=543728 OS=Variovorax paradoxus (strain S110). GN=Vapar_1701 OC=Comamonadaceae; Variovorax.
Sequence
MTDSLKTLSEHHAFGGVQSFHEHASHEIGLPMRFSVYLPPQAAQERVPALLYLAGLTCNE
ETFAVKAGAQRMAASLGLALIAPDTSPRGSIAENLPGATAHWDFGVGAGFYLDATEAPWS
THWRMESWIVHELLPLVGRHFAIDDQHLGIFGHSMGGHGALTLALRHPGRFKSLSAFAPI
CAPTQCPWGQKAFGGYLGEPGGDRAQWLAHDASALMKSQTAAPYPQGILVDQGLADKFLA
EQLNPEAFEAACFAAGQPLTLRRHAGYDHGYYFIQTFMADHIAHHAQTLRG
Download sequence
Identical sequences C5CU01
543728.Vapar_1701 WP_012746843.1.27117 WP_012746843.1.44240 WP_012746843.1.84832 gi|239814707|ref|YP_002943617.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]