SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D0LB63 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D0LB63
Domain Number 1 Region: 13-272
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 4.49e-57
Family Epoxide hydrolase 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) D0LB63
Sequence length 281
Comment (tr|D0LB63|D0LB63_GORB4) Alpha/beta hydrolase fold protein {ECO:0000313|EMBL:ACY19494.1} KW=Complete proteome; Reference proteome OX=526226 OS=NCTC 10667) (Rhodococcus bronchialis). GN=Gbro_0146 OC=Bacteria; Actinobacteria; Corynebacteriales; Gordoniaceae; Gordonia.
Sequence
MTERITEYRRGPWTFDVIDEGPADGDPVILLHGFPQRASNWDRVARLLHERGLRTIAPDQ
RGYSPRARPRRRRDYRQSELVADVVALIDELGAPRVDVVGHDWGAAVAWTLAANHPGRVR
TLTAISVPHPGAFLRAMPRAQILRSWYMLVFQLPWLPEKLLGAGMRRPGFAVRMGLPADH
DDRLADIVDSGALNGALNWYRGMPIPDPAVRMRKVTVPTTYVWSDGDPALGRAGARLCAS
WVDAPYEFEALTGANHWLPENRPREVAEAILGRVLSVDDAG
Download sequence
Identical sequences D0LB63
WP_012832086.1.40537 526226.Gbro_0146 gi|262200179|ref|YP_003271387.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]