SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D0SWR0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D0SWR0
Domain Number 1 Region: 16-211
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 2.41e-32
Family Haloperoxidase 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) D0SWR0
Sequence length 213
Comment (tr|D0SWR0|D0SWR0_ACILW) Uncharacterized protein {ECO:0000313|EMBL:EEY89430.1} KW=Complete proteome OX=575588 OS=Acinetobacter lwoffii SH145. GN=HMPREF0017_01734 OC=Moraxellaceae; Acinetobacter.
Sequence
MKLKFNMHDYAFMNQLVFLPGASGSQGFWQPLRAALTEYPDQQVIAYPGFDGVAPNVAIQ
NLYDLQELVNRQIQDDSILIAQSMGGVLAVGLALKHPQKVKGLVLLATSGGLNLKRFHCA
DWRTDYREQFKAVPNWFVQDHTEFNPDQLAGLEIPILLIWADHDPLSTIQVGQYLEKIFK
HAKLHIIQGGNHFFAHTHADQVAALIQDYLEQL
Download sequence
Identical sequences A0A2H9UKB8 D0SWR0 N9PCJ0
HMPREF0017_01734T0 WP_004280504.1.15330 WP_004280504.1.28245 WP_004280504.1.29247 WP_004280504.1.7194

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]