SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D5P9C9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D5P9C9
Domain Number 1 Region: 24-209
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 4.19e-38
Family Cutinase-like 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) D5P9C9
Sequence length 210
Comment (tr|D5P9C9|D5P9C9_9MYCO) Tat pathway signal sequence domain protein {ECO:0000313|EMBL:EFG77295.1} KW=Complete proteome OX=525368 OS=Mycobacterium parascrofulaceum ATCC BAA-614. GN=HMPREF0591_2687 OC=Mycobacterium.
Sequence
MIGRRIVVGVAAALSSAAPAGPIGLPAAAADPCPAVEVVFARGTGQASGVGQVGQAFIDA
LGPQLSGRSMGVYAVNYPATTAFATSAQAGSDDTVAHVQDMIGRCPGTRLVLGGFSQGAG
VMDLATKALPPQAAGHVAAIAVFGNPTSPLANSLAGTVFPPIGPPYAAKTIDECADGDPA
CSGGGNVLAHGSYVQSGMTTQAANFVAARL
Download sequence
Identical sequences D5P9C9
WP_007166719.1.41218

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]