SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D6Y9B1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D6Y9B1
Domain Number 1 Region: 12-244
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 1.88e-37
Family Carboxylesterase/lipase 0.00066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) D6Y9B1
Sequence length 254
Comment (tr|D6Y9B1|D6Y9B1_THEBD) Alpha/beta hydrolase {ECO:0000313|EMBL:ADG88031.1} KW=Complete proteome; Reference proteome OX=469371 OS=JCM 10125 / NBRC 14880 / R51). GN=Tbis_1312 OC=Thermobispora.
Sequence
MPVLPGAEPYHHDGGPIGVLLCHGFTGSPQSLRPWGEYLAGHGLTVSLPRLPGHGTTWQE
MNRTGWEDWYAELDKALAALRERCAEVFVMGLSLGGCLALRLAEVHPKAIRGVVAVNPSL
VCDTPLLRLAPVLKWIVPSVRGVANDIKREGVTELGYSRTPVRAAATLLRLWRLVQRDID
RIEAPVLVFRSREDHVVGPASVAFLRSRLADRVEVRELTDSYHVATLDNDAPVIFEGSLG
FIRSHASVGLPKDV
Download sequence
Identical sequences D6Y9B1
WP_013131564.1.18579 gi|296269292|ref|YP_003651924.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]