SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E1SEB6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E1SEB6
Domain Number 1 Region: 3-188
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 3.03e-19
Family Carboxylesterase/lipase 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) E1SEB6
Sequence length 193
Comment (tr|E1SEB6|E1SEB6_PANVC) Esterase yqiA {ECO:0000313|EMBL:ADO10806.1} KW=Complete proteome; Reference proteome OX=712898 OS=Pantoea vagans (strain C9-1) (Pantoea agglomerans (strain C9-1)). GN=Pvag_2646 OC=Erwiniaceae; Pantoea.
Sequence
MAALLYLHGFNSSPQSAKATQFRQWLETQHPGIEMIVPQLPTFPADAAAMLEDLVLSRSG
ETLGLVGSSLGGYYATWLSQCFMLPAVVVNPAVRPFELLADFLGENQNPYTGQQYVLESR
HIYDLKVMQIEPLEAPDLLWLLQQTGDEVLDYRQALDYYSACRHTVEEGGNHAFTGFERH
FPQILDFLGLNHP
Download sequence
Identical sequences E1SEB6
WP_013359053.1.72025 WP_013359053.1.84457 gi|308188124|ref|YP_003932255.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]