SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E6NB29 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E6NB29
Domain Number 1 Region: 10-265
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 1.92e-29
Family Haloalkane dehalogenase 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) E6NB29
Sequence length 265
Comment (tr|E6NB29|E6NB29_9ARCH) 1H-3-hydroxy-4-oxoquinaldine 2,4-dioxygenase {ECO:0000313|EMBL:BAJ49535.1} OX=311458 OS=Candidatus Caldiarchaeum subterraneum. GN=HGMM_F08G03C34 OC=Candidatus Caldiarchaeum.
Sequence
MGRLLYALSSGLKIAYEDHGRGEPVLLFMPGWCDNRTQYRDLVPFCSSRSRCLVIDWPGH
GESDTPAADFGEKELVAAAMSVIERSGARRIVTVSTAHAGWVAIELRRQLLEKIQKLVLL
DWLVLEPPQPFLEALRGLQSREHWEQVREALFSMWLSGIVDDRIVQHVRGEMGAYGFEMW
AHAGREISASYERFGSPLKALSELKPPPHVLHLFSLPKDEAYLRAQNEFAKNHQWFSVYR
LDANTHFPALEEPKTVSAFINDFIS
Download sequence
Identical sequences E6NB29

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]