SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F0Q1T9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F0Q1T9
Domain Number 1 Region: 7-264
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 3.62e-61
Family Aclacinomycin methylesterase RdmC 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F0Q1T9
Sequence length 266
Comment (tr|F0Q1T9|F0Q1T9_ACIAP) 3-oxoadipate enol-lactonase {ECO:0000313|EMBL:ADX47731.1} KW=Complete proteome OX=643561 OS=1011). GN=Acav_3840 OC=Comamonadaceae; Acidovorax.
Sequence
MAMNEVLKTAGGNFRVRVEGPVDAPALVFSNSLGTTLEMWDAQAERFARTHRVVRYDTRG
HGGSVVSSGPYTFDQLGGDVVALLDALGIERAAFCGISMGGFTGLWLGVNAPQRLERLVV
ANSAAKIGTADGWTARAAMVRDKGTAGMAELAASSPGRWFTDAFAAAQPDVVRRAQGWIA
GIAPEGYAGCCEALAHADLRAAIGGIAVPTLLIAGTADPVTTVADAQAMQAAIAGARVAE
LPASHLSNLEAPQAFDAALADFLQRD
Download sequence
Identical sequences F0Q1T9
WP_013596209.1.49867 gi|326318626|ref|YP_004236298.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]