SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F2A622 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F2A622
Domain Number 1 Region: 5-262
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 7.24e-61
Family Biotin biosynthesis protein BioH 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F2A622
Sequence length 269
Comment (tr|F2A622|F2A622_RHIET) Putative oxidoreductase protein {ECO:0000313|EMBL:EGE60081.1} KW=Complete proteome OX=993047 OS=Rhizobium etli CNPAF512. GN=RHECNPAF_173005 OC=Rhizobiaceae; Rhizobium/Agrobacterium group; Rhizobium.
Sequence
MGEAQRHTVGDVTLNYRIDGSGDPLVCIHGVGSYLEAWSGVVQRLKDQFTVLTFDLRGHG
HSSRIRGRYEIDDFVDEALALADKAGFQTFNLAGFSLGGLIAQRMALTHLERLRKLILLS
TVAGRTPEERTRVLERLAALRAGTPADHHNASLSRWLTEEFQENNPAVIARLRERDAEND
PDCYAAAYRVLAETDFGGFLDQIRCPTLIATGEADAGSNPRMARYMHERIPGSTLSILPG
LRHSILIEAPETVANLMRGFLTREETNHG
Download sequence
Identical sequences A0A0M3GBV3 A0A192PI24 B3Q5I5 F2A622
491916.RHECIAT_PC0000388 gi|190894723|ref|YP_001985016.1| gi|190894723|ref|YP_001985016.1|NC_010997 WP_004672115.1.10944 WP_004672115.1.22132 WP_004672115.1.25642 WP_004672115.1.35839 WP_004672115.1.49700 WP_004672115.1.76514 WP_004672115.1.79970 WP_004672115.1.81846 WP_004672115.1.82165

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]