SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6DDV5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6DDV5
Domain Number 1 Region: 5-92
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 3.3e-16
Family TTHA1544-like 0.00000644
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F6DDV5
Sequence length 131
Comment (tr|F6DDV5|F6DDV5_THETG) Uncharacterized protein {ECO:0000313|EMBL:AEG33957.1} KW=Complete proteome OX=762633 OS=Thermus thermophilus (strain SG0.5JP17-16). GN=Ththe16_1560 OC=Thermus.
Sequence
MRRAGYLHLYGLNLVFDRVGKGPPVLLVAEEASRWPEALPEGYAFYLLDLPGYGRTEGPR
MAPEELAHFVAGFAVMMNLGAPWVLLRGLGLALGPHLEALGLRVLPAEGVEVAEVLSSKL
SHGSIDPGGNL
Download sequence
Identical sequences F6DDV5
gi|384431724|ref|YP_005641084.1| WP_014510702.1.96068

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]