SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F9VVW6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F9VVW6
Domain Number 1 Region: 32-203
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 1.01e-25
Family Cutinase-like 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F9VVW6
Sequence length 295
Comment (tr|F9VVW6|F9VVW6_9ACTN) Uncharacterized protein {ECO:0000313|EMBL:GAA12745.1} KW=Complete proteome OX=1027371 OS=Gordonia alkanivorans NBRC 16433. GN=GOALK_056_01780 OC=Bacteria; Actinobacteria; Corynebacteriales; Gordoniaceae; Gordonia.
Sequence
MRRILAIMCTLLCAVLGGFGLSTPRADAAPAGCPKIYVLAVPGTWSNGVSPGVLGAVTSG
LGPETKVPYVGYDATAFPWEKAIYGKSKAQAVANTRGLALQMLARCPGTRIALVGYSQGA
DAAGDLASEIGTGRALIRPGQVAGVVLISDPRRSRKDNVVGPALRGEGSGGPRIDGMGWL
LPRAFTLCEPSDMYCNTPRDFYITRIAGYLAETSDPTPSQILQYQAEAAVIVRELLTLGG
PGAIVQELGNKRARDQIISFNKFLQSGSHGTYGDFQVRPGVSAVTWANRFLAGLA
Download sequence
Identical sequences F9VVW6 W9DKR9
WP_006358875.1.12224 WP_006358875.1.95232

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]