SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G2I1M7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G2I1M7
Domain Number 1 Region: 4-209
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 3.54e-48
Family Atu1826-like 0.000000859
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G2I1M7
Sequence length 221
Comment (tr|G2I1M7|G2I1M7_KOMMN) Alpha/beta hydrolase {ECO:0000313|EMBL:BAK84813.1} KW=Complete proteome; Reference proteome OX=634177 OS=1693 / Kondo 51) (Gluconacetobacter medellinensis). GN=GLX_24010 OC=Acetobacteraceae; Komagataeibacter.
Sequence
MPEVMFAGPDGRLEGRYHHSSAPNAPLALVLHPHPLHGGTMNNRITYAMYRAFEKMGFSV
MRYNSRGVGRSQGRYDGGIGEISDAAAALDWMQMINPNASGLWIAGYSFGAFVGMQLLMR
RPEITGWISVAPPANYYDFGFLAPCPCGGLMIAGENDELVPEPAIRKLVDKLNTQKGVSV
DYRIFKGADHVFADQADQVAEALEDHVSTVMNRTTLALAAD
Download sequence
Identical sequences G2I1M7
WP_014106308.1.85694 gi|347761622|ref|YP_004869183.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]