SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G7EJJ5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G7EJJ5
Domain Number 1 Region: 5-183
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 1.56e-16
Family DPP6 catalytic domain-like 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G7EJJ5
Sequence length 186
Comment (tr|G7EJJ5|G7EJJ5_9GAMM) Esterase yqiA {ECO:0000313|EMBL:GAA61103.1} KW=Complete proteome OX=388384 OS=Pseudoalteromonas sp. BSi20652. GN=P20652_2977 OC=Pseudoalteromonadaceae; Pseudoalteromonas.
Sequence
MAKRVIYIHGFNSSQKSYKAVRFGELMANYDVDYCVPNLNHEPLQAIIELEQLLTPNTVL
LGSSLGGFFATYLSQRYQIPAVVINPAVAPYNLLQSLIGPNYNPYQDYHYDLNNSHIEAL
KLLAVDKLASPELLYLLQQTGDEVLNFQHAVNYYSQCKQLIEFGGDHSYVEFERTFASIV
DFLKIT
Download sequence
Identical sequences G7EJJ5
WP_008170827.1.15647

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]