SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G7GDX4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G7GDX4
Domain Number 1 Region: 10-200
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 2.8e-19
Family Hydroxynitrile lyase-like 0.091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G7GDX4
Sequence length 203
Comment (tr|G7GDX4|G7GDX4_9GAMM) Uncharacterized protein {ECO:0000313|EMBL:GAB01799.1} KW=Complete proteome OX=1071390 OS=Acinetobacter sp. NBRC 100985. GN=ACT4_022_00640 OC=Moraxellaceae; Acinetobacter.
Sequence
MLSILVRMEIIYLHGFRSSPMSIKGQQLKHYCAKLGDVHVHLPDLNLSPDQVIKQVSALI
ETLQNQKVVLVGSSLGGFYATYFVAKYACPAVLINPAMQPWQLFQDLFGIEQIPLKVTES
WTLDHDQLQQLQSIADTKLRHADKILVLLQQGDEVLDYRQAQRYYSAAGPSSLILTDANG
NHAMDDFEEKLPLILEFLSAAIQ
Download sequence
Identical sequences G7GDX4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]