SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H6MTS4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H6MTS4
Domain Number 1 Region: 4-254
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 5.36e-33
Family Acylamino-acid-releasing enzyme, C-terminal donain 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H6MTS4
Sequence length 256
Comment (tr|H6MTS4|H6MTS4_GORPV) Uncharacterized protein {ECO:0000313|EMBL:AFA73949.1} KW=Complete proteome; Reference proteome OX=1112204 OS=Gordonia polyisoprenivorans (strain DSM 44266 / VH2). GN=GPOL_c29320 OC=Bacteria; Actinobacteria; Corynebacteriales; Gordoniaceae; Gordonia.
Sequence
MHRTAIAYGGANSQFGHIYHAAEEADLPATMRPIVLIHGGYWTTEFSLTIESAIARQYGE
RGALVWNIEYRRVGEDGGGWPHTGRDVVAAINALDGPVREALPAPVADRVDWNSVAVVGH
SAGGQLAVWATAQLRAQTANTRITTVVAQSAALDLVAAGQAGRESVQALIGRPYAQAAQR
YRAASPMEQDPFDAHVVVIHGDRDTAIPVELSRRYVSTVCARGQSAELIVVPEEGHDAFV
DPRSVCNRQTIRALGL
Download sequence
Identical sequences H6MTS4
WP_014360471.1.98463 gi|378718426|ref|YP_005283315.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]