SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H6MUI9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H6MUI9
Domain Number 1 Region: 9-215
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 1.34e-33
Family Hypothetical protein TT1662 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H6MUI9
Sequence length 221
Comment (tr|H6MUI9|H6MUI9_GORPV) Putative dienelactone hydrolase {ECO:0000313|EMBL:AFA73973.1} KW=Complete proteome; Reference proteome OX=1112204 OS=Gordonia polyisoprenivorans (strain DSM 44266 / VH2). GN=GPOL_c29560 OC=Bacteria; Actinobacteria; Corynebacteriales; Gordoniaceae; Gordonia.
Sequence
MAANTGIEPYDEGSVVATIHHPEQTPRASVVLAHGAGGNRDTAILLAYASELAGRGFAVA
RIDLPYRQRRPKGPPSPSTAAADRDGIRVACAAFRSLSAGPLVVGGHSYGGRQASMVLAE
DGAEVADGLLLSSYPLHPPGKPEKARTEHLPSITVPTLVVHGSTDPFATTDEIGAAIDLI
PAPTRLVEIAKAGHSLDPTKKPTAPLAADAVEHFLLREIGA
Download sequence
Identical sequences H6MUI9
WP_014360486.1.98463 gi|378718450|ref|YP_005283339.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]