SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H7GFR2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H7GFR2
Domain Number 1 Region: 58-208
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 0.00000000000000134
Family Haloperoxidase 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H7GFR2
Sequence length 248
Comment (tr|H7GFR2|H7GFR2_9DEIN) Carboxymethylenebutenolidase {ECO:0000313|EMBL:AMA75808.1} KW=Complete proteome OX=456163 OS=Thermus parvatiensis. GN=AV541_07060 OC=Thermus.
Sequence
MDAKRLLLLFLLAATLLAGGVVGVAFYYLRPLKAEPIAREALRGLRVIERPYGLELLPQA
PKALLAFYPGARVEPLAYAPVLAPVARAGYGVALLKVPSGIALLGKERALEAQRAHPNLP
LVVGGHSLGGVAAAELAEREGLPLLLFAAYPEGDLSGKALPTLALFGTEDGLLPPQEARE
KARRLPKGARVVFVEGLNHAGFGAYGPQRGDRPATRPREALWEEVREEVLLFLEGLGWDT
PPSPRALR
Download sequence
Identical sequences H7GFR2
WP_008632122.1.60518 WP_008632122.1.65589

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]