SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for I3CNC1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I3CNC1
Domain Number 1 Region: 2-186
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 9.53e-20
Family Haloperoxidase 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) I3CNC1
Sequence length 196
Comment (tr|I3CNC1|I3CNC1_9BURK) Esterase {ECO:0000313|EMBL:EIJ45114.1} KW=Complete proteome OX=1175306 OS=Herbaspirillum sp. GW103. GN=GWL_45540 OC=Oxalobacteraceae; Herbaspirillum.
Sequence
MILYLHGFRSSPQSFKARVMGQRMAALGLQDHYVCPQLPASPAGAIALAGALVAGVDPAR
LTVVGSSLGGYYATWLAEHTGCRAVLVNPAVKPPRDLESYVGVSTQYHSDEPFEFKREYI
AELLALAVPAITRPERYFLLAATGDEVLDWREMVAHYPGARQTVIEGSDHGMAEFADHLD
EVLAFCGVDVSGKAVR
Download sequence
Identical sequences I3CNC1
WP_008334678.1.47330

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]