SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for J3D9H4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  J3D9H4
Domain Number 1 Region: 6-196
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 9.22e-20
Family Carboxylesterase/lipase 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) J3D9H4
Sequence length 198
Comment (tr|J3D9H4|J3D9H4_9BURK) Putative esterase {ECO:0000313|EMBL:EJL87429.1} KW=Complete proteome; Reference proteome OX=1144318 OS=Polaromonas sp. CF318. GN=PMI15_01122 OC=Comamonadaceae; Polaromonas.
Sequence
MRTTHLLYLHGFRSSPQSMKAQKMAAIVRQRHPAVHWWCPQLPPSPEAALGGVMDEIAGW
PRQAGYQSLAVVGSSLGGFYATAVAERMGCKAVLLNPAVEPARDLARYIGEQTTWHDPDQ
HFFFEPRFVDELKVQHTGPLKAPENYLAIIAKGDEVLDWREMAARYAGSRLRILEGGDHA
LSDFDTHVPEILDFLALA
Download sequence
Identical sequences J3D9H4
WP_007864829.1.73815

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]