SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K2KAL0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K2KAL0
Domain Number 1 Region: 15-211
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 7.79e-21
Family Atu1826-like 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) K2KAL0
Sequence length 216
Comment (tr|K2KAL0|K2KAL0_9GAMM) Uncharacterized protein {ECO:0000313|EMBL:EKE84873.1} KW=Complete proteome; Reference proteome OX=740709 OS=Idiomarina xiamenensis 10-D-4. GN=A10D4_04655 OC=Idiomarinaceae; Idiomarina.
Sequence
MMPELSLADDVIVDNPTGRRLVVFMHGAGADSRSEFMQCIATGLAAHDCQLVRFDFPYMQ
QAKQQGRKRPPNPAPQLDLALQQLVVQLRASDDKHKPLFLLGKSMGARVAFRCADALQAK
AAIGLGFPFHPPGKPQRSRLPECFNQRAANLIIQGQRDNFCQPAWLVQQQLPDNLQIQWL
ADADHSLVPLKRSGYSAAEYWQDTVQRLATWIGAQT
Download sequence
Identical sequences K2KAL0
WP_008488041.1.80631

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]