SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K2KMN4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K2KMN4
Domain Number 1 Region: 3-192
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 0.000000000392
Family Carbon-carbon bond hydrolase 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) K2KMN4
Sequence length 194
Comment (tr|K2KMN4|K2KMN4_9GAMM) Putative esterase {ECO:0000313|EMBL:EKE83694.1} KW=Complete proteome; Reference proteome OX=740709 OS=Idiomarina xiamenensis 10-D-4. GN=A10D4_07595 OC=Idiomarinaceae; Idiomarina.
Sequence
MWLYLHGFESSPASEKAVLVGDFLRQQLTSEQSLARCYQVPAIPATVTATRELLMGLVEQ
HRQTPISGIVGSSLGGFWAHWLASQLACRALLINPAVYPAQLLQHYAGERIHPYSGERYH
LQQADLDGLRQMQTELRDDAELWVLLQRGDETLDYRLAASFYRHQRLTIEAGGNHRFAGF
SRYLPALQRFFSAP
Download sequence
Identical sequences K2KMN4
WP_008488735.1.80631

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]