SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for L7ESM9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  L7ESM9
Domain Number 1 Region: 13-193
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 0.00000000000000523
Family Hypothetical protein TT1662 0.08
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) L7ESM9
Sequence length 223
Comment (tr|L7ESM9|L7ESM9_9ACTN) Uncharacterized protein {ECO:0000313|EMBL:ELP61701.1} KW=Complete proteome; Reference proteome OX=698760 OS=Streptomyces turgidiscabies Car8. GN=STRTUCAR8_07337 OC=Streptomyces.
Sequence
MSTENTTKVVESVETVETDVGTARVTWRRAARPRLVLAVSHGAGGGIEARDLQALAGELP
AHDVTVALVEQPWRVAGKKLAPAPKTLDAGWRGIWPALAKPGLPVIAGGRSAGARVACRT
AGELGAVAVLALSFPLHPPGRPEKSRAAELLGAGVPALVVQGGNDPFGKPAEFPPGEYEL
VEVPYGDHGFAVPKRAPVGPEDVAAVITGRVVEWIASLRPSLG
Download sequence
Identical sequences L7ESM9
WP_006383408.1.33242 WP_006383408.1.80083 WP_006383408.1.95306

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]