SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for L7KVT1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  L7KVT1
Domain Number 1 Region: 19-226
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 3.46e-33
Family Hypothetical protein TT1662 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) L7KVT1
Sequence length 232
Comment (tr|L7KVT1|L7KVT1_9ACTN) Uncharacterized protein {ECO:0000313|EMBL:GAC51828.1} KW=Complete proteome OX=1220574 OS=Gordonia amicalis NBRC 100051 = JCM 11271. GN=GOAMI_04_00640 OC=Bacteria; Actinobacteria; Corynebacteriales; Gordoniaceae; Gordonia.
Sequence
MAAVTAESDESEKPGTTITVVETDDVAADVHRPDGTPRATIVLAHGAGGNRSAVILRALA
DELGSRGYVVARIDLPYRRRRPKGPPSPSTSPADRDGIRAACAMFRAESDGPLFVGGHSY
GGRQASMAVAEDGPALADGLLLSSYPLHPPGKPDRLRTEHLPSITVPTLVVHGSTDPFGT
TEEMAEAIGLIDAPTRIVELEKVGHDLNPKKKPTAALTADAVDEFLMGETSA
Download sequence
Identical sequences L7KVT1
WP_006434837.1.92255

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]