SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for N9RS14 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  N9RS14
Domain Number 1 Region: 9-259
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 3.92e-58
Family Proline iminopeptidase-like 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) N9RS14
Sequence length 261
Comment (tr|N9RS14|N9RS14_9GAMM) 3-oxoadipate enol-lactonase {ECO:0000313|EMBL:ENX60768.1} KW=Complete proteome OX=1217701 OS=Acinetobacter sp. ANC 3880. GN=F885_01876 OC=Moraxellaceae; Acinetobacter.
Sequence
MITHINNRQGHPLAVQVQGLKDAPVIMFSNSLGTDHGMWQAQVAALADHYQIISYDTRGH
GASAVIANSTLQNLVEDVVDILDALAIEKVHFCGISMGGITALALAIYHAERFHSISVAN
SAAKIGTAEAWNTRADSVEQNGLAEIVKTTHTRWFSEHFDYAHDVLAQKTIQSLAVTPAQ
GYANACRALADADVRDQLHQIQIPTLIIAGQYDPVTTVQDAEFMHQLIATSQLEILAASH
LSNIEQPQVFNQTLSKFIQNI
Download sequence
Identical sequences N9RS14 N9SM42
WP_005213076.1.45252 WP_005213076.1.62036

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]