SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q0A4W6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q0A4W6
Domain Number 1 Region: 6-260
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 1.07e-56
Family Epoxide hydrolase 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q0A4W6
Sequence length 261
Comment (tr|Q0A4W6|Q0A4W6_ALKEH) Alpha/beta hydrolase fold protein {ECO:0000313|EMBL:ABI58121.1} KW=Complete proteome; Reference proteome OX=187272 OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1). GN=Mlg_2781 OC=Ectothiorhodospiraceae; Alkalilimnicola.
Sequence
MTEILRLNKTERGDGPPLLILHGLYGSSANWSRHARWLAERHRVILPDLRNHGRSPHHPR
MDYPAMAADLVQLLDDCGCAQALVMGHSMGGKAAMALALEHPERVSGLVVADIAPVDYGT
EDHGHDGILAAMAGVDLDGISHREQVDTALAEAVDSPMVRQFLLTNLQRGEQGWEWRIPV
AILRQALPTLMGFPDYDGQYAGPALFIHGERSGYVQAAQTDAIRRLFPHAEITAVAGAGH
WLHVEQPERFAEALDAWLRRR
Download sequence
Identical sequences Q0A4W6
WP_011630514.1.71132 187272.Mlg_2781 gi|114321928|ref|YP_743611.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]